Anti WDR35 pAb (ATL-HPA044147)

Atlas Antibodies

Catalog No.: ATL-HPA044147-25

Protein Description: WD repeat domain 35
Gene Name: WDR35
Alternative Gene Name: IFT121, IFTA1, KIAA1336, MGC33196
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066643: 93%, ENSRNOG00000028783: 93%
Entrez Gene ID: 57539
Uniprot ID: Q9P2L0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLPNVGLIQKYSLNCRAYQLSLNCNSSRLAIIDISGVLTFFDLDARVTDSTGQQVVGELLKLERRDVWDMKWAKDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGY
• Gene Sequence: SLPNVGLIQKYSLNCRAYQLSLNCNSSRLAIIDISGVLTFFDLDARVTDSTGQQVVGELLKLERRDVWDMKWAKDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGY
• Gene ID - Mouse: ENSMUSG00000066643
• Gene ID - Rat: ENSRNOG00000028783
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti WDR35 pAb (ATL-HPA044147) – 1 Found

Duran, Ivan; Taylor, S Paige; Zhang, Wenjuan; Martin, Jorge; Qureshi, Faisal; Jacques, Suzanne M; Wallerstein, Robert; Lachman, Ralph S; Nickerson, Deborah A; Bamshad, Michael; Cohn, Daniel H; Krakow, Deborah. Mutations in IFT-A satellite core component genes IFT43 and IFT121 produce short rib polydactyly syndrome with distinctive campomelia. Cilia. 6( 28400947):7.