Anti WDR12 pAb (ATL-HPA036389)

Atlas Antibodies

Catalog No.: ATL-HPA036389-25

Protein Description: WD repeat domain 12
Gene Name: WDR12
Alternative Gene Name: FLJ10881, YTM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026019: 86%, ENSRNOG00000017340: 87%
Entrez Gene ID: 55759
Uniprot ID: Q9GZL7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAQLQTRFYTDNKKYAVDDVPFSIPAASEIADLSNIINKLLKDKNEFHKHVEFDFLIKGQFLRMPLDKHMEMENISSEEVVEI
• Gene Sequence: MAQLQTRFYTDNKKYAVDDVPFSIPAASEIADLSNIINKLLKDKNEFHKHVEFDFLIKGQFLRMPLDKHMEMENISSEEVVEI
• Gene ID - Mouse: ENSMUSG00000026019
• Gene ID - Rat: ENSRNOG00000017340
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti WDR12 pAb (ATL-HPA036389) – 1 Found

Arabi, Azadeh; Ullah, Karim; Branca, Rui M M; Johansson, Johan; Bandarra, Daniel; Haneklaus, Moritz; Fu, Jing; Ariës, Ingrid; Nilsson, Peter; Den Boer, Monique L; Pokrovskaja, Katja; Grandér, Dan; Xiao, Gutian; Rocha, Sonia; Lehtiö, Janne; Sangfelt, Olle. Proteomic screen reveals Fbw7 as a modulator of the NF-κB pathway. Nature Communications. 3( 22864569):976.