Anti WDFY3 pAb (ATL-HPA042734)

Atlas Antibodies

Catalog No.: ATL-HPA042734-25

Protein Description: WD repeat and FYVE domain containing 3
Gene Name: WDFY3
Alternative Gene Name: ALFY, KIAA0993, ZFYVE25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043940: 95%, ENSRNOG00000061121: 89%
Entrez Gene ID: 23001
Uniprot ID: Q8IZQ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AWCTDSGSDDSRRWSDQLSLDEKDGFIFVNYSEGQTRAHLQGPLSHPHPNPIEVRNYSRLKPGYRWERQLVFRSKLTMH
• Gene Sequence: AWCTDSGSDDSRRWSDQLSLDEKDGFIFVNYSEGQTRAHLQGPLSHPHPNPIEVRNYSRLKPGYRWERQLVFRSKLTMH
• Gene ID - Mouse: ENSMUSG00000043940
• Gene ID - Rat: ENSRNOG00000061121
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.