Anti WBP1L pAb (ATL-HPA038371 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038371-100

Protein Description: WW domain binding protein 1-like
Gene Name: WBP1L
Alternative Gene Name: C10orf26, FLJ20154, OPAL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047731: 95%, ENSRNOG00000020020: 95%
Entrez Gene ID: 54838
Uniprot ID: Q9NX94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSGIEVCVCNRGHHDDDLKEFNTLIDDALDGPLDFCDSCHVRPPGDEEEGLCQSSEEQAREPGHPHLPRPPACLLLNTINEQDSPNSQ
• Gene Sequence: DSGIEVCVCNRGHHDDDLKEFNTLIDDALDGPLDFCDSCHVRPPGDEEEGLCQSSEEQAREPGHPHLPRPPACLLLNTINEQDSPNSQ
• Gene ID - Mouse: ENSMUSG00000047731
• Gene ID - Rat: ENSRNOG00000020020
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti WBP1L pAb (ATL-HPA038371 w/enhanced validation) – 1 Found

Xu, Jiajun; Chen, Zhixi; Fang, Zheng; Chen, Shixiong; Guo, Ying; Liu, Xianfeng; Chen, Kai; Chen, Shengjia. Long non-coding RNA OIP5-AS1 promotes the progression of esophageal cancer by regulating miR-30a/VOPP1 expression. Oncology Letters. 2021;22(3):651.