Anti WBP1L pAb (ATL-HPA037635)

Atlas Antibodies

Catalog No.: ATL-HPA037635-25

Protein Description: WW domain binding protein 1-like
Gene Name: WBP1L
Alternative Gene Name: C10orf26, FLJ20154, OPAL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047731: 70%, ENSRNOG00000020020: 76%
Entrez Gene ID: 54838
Uniprot ID: Q9NX94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLSEPSRSSTRPPSIADPDPSDLPVDRAATKAPGMEPSGSVAGLGELDPGAFLDKDAECREELLKDDSSEHGAPDSKEKTPGRHRRFTGD
• Gene Sequence: PLSEPSRSSTRPPSIADPDPSDLPVDRAATKAPGMEPSGSVAGLGELDPGAFLDKDAECREELLKDDSSEHGAPDSKEKTPGRHRRFTGD
• Gene ID - Mouse: ENSMUSG00000047731
• Gene ID - Rat: ENSRNOG00000020020
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.