Anti VWCE pAb (ATL-HPA040401)

Atlas Antibodies

Catalog No.: ATL-HPA040401-25

Protein Description: von Willebrand factor C and EGF domains
Gene Name: VWCE
Alternative Gene Name: FLJ32009, URG11, VWC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043789: 83%, ENSRNOG00000060269: 81%
Entrez Gene ID: 220001
Uniprot ID: Q96DN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKVRCEAACSHPIPSRDGGCCPSCTGCFHSGVVRAEGDVFSPPNENCTVCVCLAGNVSCISPECPSGPCQTPPQTDCCTCVPVRCYFHG
• Gene Sequence: EKVRCEAACSHPIPSRDGGCCPSCTGCFHSGVVRAEGDVFSPPNENCTVCVCLAGNVSCISPECPSGPCQTPPQTDCCTCVPVRCYFHG
• Gene ID - Mouse: ENSMUSG00000043789
• Gene ID - Rat: ENSRNOG00000060269
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.