Anti VWA5B2 pAb (ATL-HPA036823)

Atlas Antibodies

Catalog No.: ATL-HPA036823-25

Protein Description: von Willebrand factor A domain containing 5B2
Gene Name: VWA5B2
Alternative Gene Name: DKFZp761K032, LOC90113
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046613: 80%, ENSRNOG00000001707: 75%
Entrez Gene ID: 90113
Uniprot ID: Q8N398
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PRKPSLGAILDGPSPEPGQQLGQGLDDSGNLLSPAPMDWDMLMEPPFLFTAVPPSGELAPPAVPPQAPRCHVVIRGLCGEQP
• Gene Sequence: PRKPSLGAILDGPSPEPGQQLGQGLDDSGNLLSPAPMDWDMLMEPPFLFTAVPPSGELAPPAVPPQAPRCHVVIRGLCGEQP
• Gene ID - Mouse: ENSMUSG00000046613
• Gene ID - Rat: ENSRNOG00000001707
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti VWA5B2 pAb (ATL-HPA036823) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.