Anti-VSIG4 pAb (ATL-HPA072756)

Atlas Antibodies

Catalog No.:
ATL-HPA072756-100
Immunohistochemical staining of human lung shows cytoplasmic positivity in macrophages.
Lane 1: Marker [kDa] 250,130,95,72,55,36,28,17,10<br/>Lane 2: RT-4<br/>Lane 3: U-251MG<br/>Lane 4: Human Plasma<br/>Lane 5: Liver<br/>Lane 6: Tonsil
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Polyclonal Antibody against Human VSIG4, Gene description: V-set and immunoglobulin domain containing 4, Alternative Gene Names: CRIg, Z39IG, Validated applications: IHC, WB, Uniprot ID: Q9Y279, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC, WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVV
Gene Sequence KGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVV
Gene ID - Mouse ENSMUSG00000044206
Gene ID - Rat ENSRNOG00000038132
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti-VSIG4 pAb (ATL-HPA072756)
Vendor Page Anti-VSIG4 pAb (ATL-HPA072756) at Atlas Antibodies

Documents & Links for Anti-VSIG4 pAb (ATL-HPA072756)
Vendor Page Anti-VSIG4 pAb (ATL-HPA072756)
!