Anti VSIG1 pAb (ATL-HPA036311)

Atlas Antibodies

Catalog No.: ATL-HPA036311-25

Protein Description: V-set and immunoglobulin domain containing 1
Gene Name: VSIG1
Alternative Gene Name: MGC44287
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031340: 50%, ENSRNOG00000061182: 50%
Entrez Gene ID: 340547
Uniprot ID: Q86XK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EPKPTQEPAPEPAPGSEPMAVPDLDIELELEPETQSELEPEPEPEPESEPGVVVEPLSEDEKGVVK
• Gene Sequence: EPKPTQEPAPEPAPGSEPMAVPDLDIELELEPETQSELEPEPEPEPESEPGVVVEPLSEDEKGVVK
• Gene ID - Mouse: ENSMUSG00000031340
• Gene ID - Rat: ENSRNOG00000061182
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti VSIG1 pAb (ATL-HPA036311) – 1 Found

Kövecsi, Attila; Gurzu, Simona; Szentirmay, Zoltan; Kovacs, Zsolt; Bara, Tivadar Jr; Jung, Ioan. Paradoxical expression pattern of the epithelial mesenchymal transition-related biomarkers CD44, SLUG, N-cadherin and VSIG1/Glycoprotein A34 in gastrointestinal stromal tumors. World Journal Of Gastrointestinal Oncology. 2017;9(11):436-443.