Anti VPS37B pAb (ATL-HPA038218 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038218-100

Protein Description: vacuolar protein sorting 37 homolog B (S. cerevisiae)
Gene Name: VPS37B
Alternative Gene Name: FLJ12750
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066278: 84%, ENSRNOG00000001086: 85%
Entrez Gene ID: 79720
Uniprot ID: Q9H9H4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQNVQLNKEMTLASNRSLAEGNLLYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSSASL
• Gene Sequence: GSEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQNVQLNKEMTLASNRSLAEGNLLYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSSASL
• Gene ID - Mouse: ENSMUSG00000066278
• Gene ID - Rat: ENSRNOG00000001086
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.