Anti VPS35 pAb (ATL-HPA040802 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040802-100

Protein Description: vacuolar protein sorting 35 homolog (S. cerevisiae)
Gene Name: VPS35
Alternative Gene Name: FLJ10752, MEM3, PARK17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031696: 97%, ENSRNOG00000017612: 98%
Entrez Gene ID: 55737
Uniprot ID: Q96QK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SCYVLSNVLDYNTEIVSQDQVDSIMNLVSTLIQDQPDQPVEDPDPEDFADEQSLVGRFIHLLRSEDPDQQYLILNTARKHFGAGGNQRIRFTLPPLVFAAYQLAFRYKENSKVDD
• Gene Sequence: SCYVLSNVLDYNTEIVSQDQVDSIMNLVSTLIQDQPDQPVEDPDPEDFADEQSLVGRFIHLLRSEDPDQQYLILNTARKHFGAGGNQRIRFTLPPLVFAAYQLAFRYKENSKVDD
• Gene ID - Mouse: ENSMUSG00000031696
• Gene ID - Rat: ENSRNOG00000017612
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti VPS35 pAb (ATL-HPA040802 w/enhanced validation) – 1 Found

Halff, Els F; Szulc, Blanka R; Lesept, Flavie; Kittler, Josef T. SNX27-Mediated Recycling of Neuroligin-2 Regulates Inhibitory Signaling. Cell Reports. 2019;29(9):2599-2607.e6.