Anti VAMP7 pAb (ATL-HPA036733)

Atlas Antibodies

Catalog No.: ATL-HPA036733-25

Protein Description: vesicle-associated membrane protein 7
Gene Name: VAMP7
Alternative Gene Name: SYBL1, TI-VAMP, VAMP-7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051412: 98%, ENSRNOG00000008372: 93%
Entrez Gene ID: 6845
Uniprot ID: P51809
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNL
• Gene Sequence: YAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNL
• Gene ID - Mouse: ENSMUSG00000051412
• Gene ID - Rat: ENSRNOG00000008372
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti VAMP7 pAb (ATL-HPA036733) – 1 Found

Tannour-Louet, Mounia; Han, Shuo; Louet, Jean-Francois; Zhang, Bin; Romero, Karina; Addai, Josephine; Sahin, Aysegul; Cheung, Sau Wai; Lamb, Dolores J. Increased gene copy number of VAMP7 disrupts human male urogenital development through altered estrogen action. Nature Medicine. 2014;20(7):715-24.