Anti USP11 pAb (ATL-HPA037536 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA037536-25

Protein Description: ubiquitin specific peptidase 11
Gene Name: USP11
Alternative Gene Name: UHX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031066: 82%, ENSRNOG00000009049: 83%
Entrez Gene ID: 8237
Uniprot ID: P51784
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC, ChIP-Exo-Seq
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VEPQEDTRLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQLHVMNNNMSEEDEDFKGQPGICGLTNLGNT
• Gene Sequence: VEPQEDTRLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQLHVMNNNMSEEDEDFKGQPGICGLTNLGNT
• Gene ID - Mouse: ENSMUSG00000031066
• Gene ID - Rat: ENSRNOG00000009049
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti USP11 pAb (ATL-HPA037536 w/enhanced validation) – 1 Found

Shah, Palak; Qiang, Lei; Yang, Seungwon; Soltani, Keyoumars; He, Yu-Ying. Regulation of XPC deubiquitination by USP11 in repair of UV-induced DNA damage. Oncotarget. 2017;8(57):96522-96535.