Anti UQCRFS1 pAb (ATL-HPA041863 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041863-25

Protein Description: ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1
Gene Name: UQCRFS1
Alternative Gene Name: RIP1, RIS1, RISP, UQCR5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038462: 94%, ENSRNOG00000018281: 94%
Entrez Gene ID: 7386
Uniprot ID: P47985
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIV
• Gene Sequence: RVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIV
• Gene ID - Mouse: ENSMUSG00000038462
• Gene ID - Rat: ENSRNOG00000018281
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UQCRFS1 pAb (ATL-HPA041863 w/enhanced validation) – 2 Found

Tegelberg, Saara; Tomašić, Nikica; Kallijärvi, Jukka; Purhonen, Janne; Elmér, Eskil; Lindberg, Eva; Nord, David Gisselsson; Soller, Maria; Lesko, Nicole; Wedell, Anna; Bruhn, Helene; Freyer, Christoph; Stranneheim, Henrik; Wibom, Rolf; Nennesmo, Inger; Wredenberg, Anna; Eklund, Erik A; Fellman, Vineta. Respiratory chain complex III deficiency due to mutated BCS1L: a novel phenotype with encephalomyopathy, partially phenocopied in a Bcs1l mutant mouse model. Orphanet Journal Of Rare Diseases. 2017;12(1):73. 

Desmurs, Marjorie; Foti, Michelangelo; Raemy, Etienne; Vaz, Frédéric Maxime; Martinou, Jean-Claude; Bairoch, Amos; Lane, Lydie. C11orf83, a mitochondrial cardiolipin-binding protein involved in bc1 complex assembly and supercomplex stabilization. Molecular And Cellular Biology. 2015;35(7):1139-56.