Anti UFM1 pAb (ATL-HPA039758)

Atlas Antibodies

Catalog No.: ATL-HPA039758-25

Protein Description: ubiquitin-fold modifier 1
Gene Name: UFM1
Alternative Gene Name: bA131P10.1, C13orf20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027746: 64%, ENSRNOG00000038176: 63%
Entrez Gene ID: 51569
Uniprot ID: P61960
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IRAFPTTTPRSLHLFTSSTFLARALPGAFPTGACEERLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC
• Gene Sequence: IRAFPTTTPRSLHLFTSSTFLARALPGAFPTGACEERLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC
• Gene ID - Mouse: ENSMUSG00000027746
• Gene ID - Rat: ENSRNOG00000038176
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.