Anti UBTD2 pAb (ATL-HPA035892 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035892-25

Protein Description: ubiquitin domain containing 2
Gene Name: UBTD2
Alternative Gene Name: DC-UbP, MGC30022
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044949: 95%, ENSRNOG00000004137: 95%
Entrez Gene ID: 92181
Uniprot ID: Q8WUN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQVIVSQPVQNPTPV
• Gene Sequence: TVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQVIVSQPVQNPTPV
• Gene ID - Mouse: ENSMUSG00000044949
• Gene ID - Rat: ENSRNOG00000004137
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.