Anti UBL4B pAb (ATL-HPA031364 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031364-25

Protein Description: ubiquitin-like 4B
Gene Name: UBL4B
Alternative Gene Name: FLJ25690
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055891: 74%, ENSRNOG00000053061: 47%
Entrez Gene ID: 164153
Uniprot ID: Q8N7F7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVPEEQQHLLFRGQLLEDDKHLSDYCIGPNASINVIMQPLEKMALKEAHQPQTQPLWHQLGLVLAKHFEP
• Gene Sequence: KVPEEQQHLLFRGQLLEDDKHLSDYCIGPNASINVIMQPLEKMALKEAHQPQTQPLWHQLGLVLAKHFEP
• Gene ID - Mouse: ENSMUSG00000055891
• Gene ID - Rat: ENSRNOG00000053061
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.