Anti UBE3A pAb (ATL-HPA039410)

Atlas Antibodies

Catalog No.: ATL-HPA039410-25

Protein Description: ubiquitin protein ligase E3A
Gene Name: UBE3A
Alternative Gene Name: ANCR, AS, E6-AP, EPVE6AP, FLJ26981, HPVE6A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025326: 96%, ENSRNOG00000015734: 96%
Entrez Gene ID: 7337
Uniprot ID: Q05086
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIK
• Gene Sequence: HLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIK
• Gene ID - Mouse: ENSMUSG00000025326
• Gene ID - Rat: ENSRNOG00000015734
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UBE3A pAb (ATL-HPA039410) – 1 Found

Bailus, Barbara J; Pyles, Benjamin; McAlister, Michelle M; O'Geen, Henriette; Lockwood, Sarah H; Adams, Alexa N; Nguyen, Jennifer Trang T; Yu, Abigail; Berman, Robert F; Segal, David J. Protein Delivery of an Artificial Transcription Factor Restores Widespread Ube3a Expression in an Angelman Syndrome Mouse Brain. Molecular Therapy : The Journal Of The American Society Of Gene Therapy. 2016;24(3):548-55.