Anti UBC pAb (ATL-HPA041344)

Atlas Antibodies

Catalog No.:
ATL-HPA041344-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: ubiquitin C
Gene Name: UBC
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000103034: 100%, ENSRNOG00000057823: 100%
Entrez Gene ID: 7316
Uniprot ID: P0CG48
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQ
Gene Sequence MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQ
Gene ID - Mouse ENSMUSG00000103034
Gene ID - Rat ENSRNOG00000057823
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBC pAb (ATL-HPA041344)
Datasheet Anti UBC pAb (ATL-HPA041344) Datasheet (External Link)
Vendor Page Anti UBC pAb (ATL-HPA041344) at Atlas Antibodies

Documents & Links for Anti UBC pAb (ATL-HPA041344)
Datasheet Anti UBC pAb (ATL-HPA041344) Datasheet (External Link)
Vendor Page Anti UBC pAb (ATL-HPA041344)