Anti TXNIP pAb (ATL-HPA031085)

Atlas Antibodies

Catalog No.: ATL-HPA031085-25

Protein Description: thioredoxin interacting protein
Gene Name: TXNIP
Alternative Gene Name: EST01027, HHCPA78, THIF, VDUP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038393: 96%, ENSRNOG00000021201: 96%
Entrez Gene ID: 10628
Uniprot ID: Q9H3M7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQPTGENEM
• Gene Sequence: FEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQPTGENEM
• Gene ID - Mouse: ENSMUSG00000038393
• Gene ID - Rat: ENSRNOG00000021201
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TXNIP pAb (ATL-HPA031085) – 2 Found

Chen, D; Dang, Bian-Li; Huang, Jin-zhou; Chen, Min; Wu, Di; Xu, Man-Li; Li, Rong; Yan, Guang-Rong. MiR-373 drives the epithelial-to-mesenchymal transition and metastasis via the miR-373-TXNIP-HIF1α-TWIST signaling axis in breast cancer. Oncotarget. 2015;6(32):32701-12. 

Gunes, Aysim; Bagirsakci, Ezgi; Iscan, Evin; Cakan-Akdogan, Gulcin; Aykutlu, Umut; Senturk, Serif; Ozhan, Gunes; Erdal, Esra; Nart, Deniz; Barbet, Funda Yilmaz; Atabey, Nese. Thioredoxin interacting protein promotes invasion in hepatocellular carcinoma. Oncotarget. 2018;9(96):36849-36866.