Anti TXNDC9 pAb (ATL-HPA031845)

Atlas Antibodies

Catalog No.: ATL-HPA031845-25

Protein Description: thioredoxin domain containing 9
Gene Name: TXNDC9
Alternative Gene Name: APACD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058407: 95%, ENSRNOG00000018593: 93%
Entrez Gene ID: 10190
Uniprot ID: O14530
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD
• Gene Sequence: TQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD
• Gene ID - Mouse: ENSMUSG00000058407
• Gene ID - Rat: ENSRNOG00000018593
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TXNDC9 pAb (ATL-HPA031845) – 1 Found

Ma, Fanhua; Hou, Liming; Yang, Liguo. Txndc9 Is Required for Meiotic Maturation of Mouse Oocytes. Biomed Research International. 2017( 28626760):6265890.