Anti TUBGCP4 pAb (ATL-HPA043212 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043212-25

Protein Description: tubulin, gamma complex associated protein 4
Gene Name: TUBGCP4
Alternative Gene Name: 76P, FLJ14797
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027263: 100%, ENSRNOG00000012798: 99%
Entrez Gene ID: 27229
Uniprot ID: Q9UGJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ILFVGESVQMFENQNVNLTRKGSILKNQEDTFAAELHRLKQQPLFSLVDFEQVVDRIRSTVAEHLWKLMVEESDLLGQLKIIKDFYLLGRGELFQAFIDTAQHMLKTPPTA
• Gene Sequence: ILFVGESVQMFENQNVNLTRKGSILKNQEDTFAAELHRLKQQPLFSLVDFEQVVDRIRSTVAEHLWKLMVEESDLLGQLKIIKDFYLLGRGELFQAFIDTAQHMLKTPPTA
• Gene ID - Mouse: ENSMUSG00000027263
• Gene ID - Rat: ENSRNOG00000012798
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.