Anti TTC39B pAb (ATL-HPA054804)

Atlas Antibodies

Catalog No.: ATL-HPA054804-25

Protein Description: tetratricopeptide repeat domain 39B
Gene Name: TTC39B
Alternative Gene Name: C9orf52, FLJ33868
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038172: 94%, ENSRNOG00000042603: 94%
Entrez Gene ID: 158219
Uniprot ID: Q5VTQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKGCCLKNLQRPLQAELCYNHVVESEKLLKYDHYLVPFTLFELASLYKSQGEIDKAIKFLETARNNYKDYS
• Gene Sequence: LKGCCLKNLQRPLQAELCYNHVVESEKLLKYDHYLVPFTLFELASLYKSQGEIDKAIKFLETARNNYKDYS
• Gene ID - Mouse: ENSMUSG00000038172
• Gene ID - Rat: ENSRNOG00000042603
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.