Anti TTC36 pAb (ATL-HPA038731 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038731-25

Protein Description: tetratricopeptide repeat domain 36
Gene Name: TTC36
Alternative Gene Name: HBP21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039438: 83%, ENSRNOG00000014700: 81%
Entrez Gene ID: 143941
Uniprot ID: A6NLP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GTPNDQAVLQAIFNPDTPFGDIVGLDLGEEAEKEEREEDEVFPQAQLEQSKALELQGVMAAEA
• Gene Sequence: GTPNDQAVLQAIFNPDTPFGDIVGLDLGEEAEKEEREEDEVFPQAQLEQSKALELQGVMAAEA
• Gene ID - Mouse: ENSMUSG00000039438
• Gene ID - Rat: ENSRNOG00000014700
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.