Anti TTC21B pAb (ATL-HPA035495)

Atlas Antibodies

Catalog No.: ATL-HPA035495-25

Protein Description: tetratricopeptide repeat domain 21B
Gene Name: TTC21B
Alternative Gene Name: FLJ11457, IFT139, JBTS11, NPHP12, THM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034848: 86%, ENSRNOG00000005868: 86%
Entrez Gene ID: 79809
Uniprot ID: Q7Z4L5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALAHEPVNELSALMEDGRCQVLLAKVYSKMEKLGDAITALQQARELQARVLKRVQMEQPDAVPAQKHLAAEICAEIAKHSVAQRDYE
• Gene Sequence: ALAHEPVNELSALMEDGRCQVLLAKVYSKMEKLGDAITALQQARELQARVLKRVQMEQPDAVPAQKHLAAEICAEIAKHSVAQRDYE
• Gene ID - Mouse: ENSMUSG00000034848
• Gene ID - Rat: ENSRNOG00000005868
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TTC21B pAb (ATL-HPA035495) – 1 Found

Xu, Yanan; Cao, Jingli; Huang, Shan; Feng, Di; Zhang, Wei; Zhu, Xueliang; Yan, Xiumin. Characterization of tetratricopeptide repeat-containing proteins critical for cilia formation and function. Plos One. 10(4):e0124378.