Anti TTC1 pAb (ATL-HPA036557)

Atlas Antibodies

Catalog No.: ATL-HPA036557-100

Protein Description: tetratricopeptide repeat domain 1
Gene Name: TTC1
Alternative Gene Name: TPR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041278: 99%, ENSRNOG00000003980: 97%
Entrez Gene ID: 7265
Uniprot ID: Q99614
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSIHQAREACMRLPKQIEERNERLKEEMLGKLKDLGNLVLRPFGLSTENFQIKQDSSTGSYSINFVQNPNNNR
• Gene Sequence: PSIHQAREACMRLPKQIEERNERLKEEMLGKLKDLGNLVLRPFGLSTENFQIKQDSSTGSYSINFVQNPNNNR
• Gene ID - Mouse: ENSMUSG00000041278
• Gene ID - Rat: ENSRNOG00000003980
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.