Anti TTBK1 pAb (ATL-HPA031736 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031736-25

Protein Description: tau tubulin kinase 1
Gene Name: TTBK1
Alternative Gene Name: KIAA1855
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015599: 82%, ENSRNOG00000018416: 85%
Entrez Gene ID: 84630
Uniprot ID: Q5TCY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLVMEKRQGRLLLRLASGASSSSSEEQRRASETLSGTGSEEDTPASEPAAALPRKSGRAAATRSRIPRPIGLRMPMPVAAQQ
• Gene Sequence: RLVMEKRQGRLLLRLASGASSSSSEEQRRASETLSGTGSEEDTPASEPAAALPRKSGRAAATRSRIPRPIGLRMPMPVAAQQ
• Gene ID - Mouse: ENSMUSG00000015599
• Gene ID - Rat: ENSRNOG00000018416
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TTBK1 pAb (ATL-HPA031736 w/enhanced validation) – 1 Found

Lund, Harald; Cowburn, Richard F; Gustafsson, Elin; Strömberg, Kia; Svensson, Anne; Dahllund, Leif; Malinowsky, David; Sunnemark, Dan. Tau-tubulin kinase 1 expression, phosphorylation and co-localization with phospho-Ser422 tau in the Alzheimer's disease brain. Brain Pathology (Zurich, Switzerland). 2013;23(4):378-89.