Anti TSEN34 pAb (ATL-HPA048208)

Atlas Antibodies

SKU: ATL-HPA048208-25

• 

Protein Description: TSEN34 tRNA splicing endonuclease subunit
Gene Name: TSEN34
Alternative Gene Name: LENG5, SEN34, SEN34L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035585: 75%, ENSRNOG00000055179: 76%
Entrez Gene ID: 79042
Uniprot ID: Q9BSV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLEQASGASSSQEAGSSQAAKEDETSDGQASGEQEEAGPSSSQAGPSNGVAPLPRSALLVQLATARPRPVKARPLDWRVQSKDWPH
• Gene Sequence: KLEQASGASSSQEAGSSQAAKEDETSDGQASGEQEEAGPSSSQAGPSNGVAPLPRSALLVQLATARPRPVKARPLDWRVQSKDWPH
• Gene ID - Mouse: ENSMUSG00000035585
• Gene ID - Rat: ENSRNOG00000055179
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.