Anti TRRAP pAb (ATL-HPA054376)

Atlas Antibodies

Catalog No.: ATL-HPA054376-25

Protein Description: transformation/transcription domain-associated protein
Gene Name: TRRAP
Alternative Gene Name: PAF400, TR-AP, Tra1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045482: 99%, ENSRNOG00000019497: 21%
Entrez Gene ID: 8295
Uniprot ID: Q9Y4A5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TWVQLFPRLWKILSDRQQHALAGEISPFLCSGSHQVQRDCQPSALNCFVEAMSQCVPPIPIRPCVLKYLGKTHNLWFRSTLMLEHQ
• Gene Sequence: TWVQLFPRLWKILSDRQQHALAGEISPFLCSGSHQVQRDCQPSALNCFVEAMSQCVPPIPIRPCVLKYLGKTHNLWFRSTLMLEHQ
• Gene ID - Mouse: ENSMUSG00000045482
• Gene ID - Rat: ENSRNOG00000019497
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.