Anti TRPM2 pAb (ATL-HPA035260 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035260-25

Protein Description: transient receptor potential cation channel, subfamily M, member 2
Gene Name: TRPM2
Alternative Gene Name: EREG1, KNP3, LTRPC2, NUDT9H, NUDT9L1, TRPC7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009292: 91%, ENSRNOG00000001216: 94%
Entrez Gene ID: 7226
Uniprot ID: O94759
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTNGTPCVVVEGSGRVADVIAQVANLPVSDITISLIQQKLSVFFQEMFETFTESRIVEWTKKIQDIVRRRQLLTVFREGKDGQQDV
• Gene Sequence: RTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTNGTPCVVVEGSGRVADVIAQVANLPVSDITISLIQQKLSVFFQEMFETFTESRIVEWTKKIQDIVRRRQLLTVFREGKDGQQDV
• Gene ID - Mouse: ENSMUSG00000009292
• Gene ID - Rat: ENSRNOG00000001216
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRPM2 pAb (ATL-HPA035260 w/enhanced validation) – 2 Found

Wang, Xingbang; Xiao, Yong; Huang, Mingming; Shen, Bing; Xue, Haowei; Wu, Kaile. Effect of TRPM2-Mediated Calcium Signaling on Cell Proliferation and Apoptosis in Esophageal Squamous Cell Carcinoma. Technology In Cancer Research & Treatment. 2021;20( 34605693):15330338211045213. 

Hack, Carsten Theo; Buck, Theresa; Bagnjuk, Konstantin; Eubler, Katja; Kunz, Lars; Mayr, Doris; Mayerhofer, Artur. A Role for H(2)O(2) and TRPM2 in the Induction of Cell Death: Studies in KGN Cells. Antioxidants (Basel, Switzerland). 2019;8(11)