Anti TRNAU1AP pAb (ATL-HPA032069 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA032069-100

Protein Description: tRNA selenocysteine 1 associated protein 1
Gene Name: TRNAU1AP
Alternative Gene Name: FLJ20503, SECP43, TRSPAP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028898: 99%, ENSRNOG00000055344: 100%
Entrez Gene ID: 54952
Uniprot ID: Q9NX07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQTGVSKGYGFVKFTDELEQK
• Gene Sequence: KLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQTGVSKGYGFVKFTDELEQK
• Gene ID - Mouse: ENSMUSG00000028898
• Gene ID - Rat: ENSRNOG00000055344
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.