Anti TRMT2B pAb (ATL-HPA035120)

Atlas Antibodies

Catalog No.: ATL-HPA035120-25

Protein Description: tRNA methyltransferase 2 homolog B (S. cerevisiae)
Gene Name: TRMT2B
Alternative Gene Name: CXorf34, FLJ12687
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067369: 78%, ENSRNOG00000001885: 32%
Entrez Gene ID: 79979
Uniprot ID: Q96GJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FYLGTWRDGNVVCVQSNHLKNIPEKHSQVAQYYEVFLRQSPLEPCLVFHEGGYWRELTVRTNSQGHTMAIITFHPQKLSQEELHVQKEIVKE
• Gene Sequence: FYLGTWRDGNVVCVQSNHLKNIPEKHSQVAQYYEVFLRQSPLEPCLVFHEGGYWRELTVRTNSQGHTMAIITFHPQKLSQEELHVQKEIVKE
• Gene ID - Mouse: ENSMUSG00000067369
• Gene ID - Rat: ENSRNOG00000001885
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.