Anti TRMT112 pAb (ATL-HPA039901 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039901-25

Protein Description: tRNA methyltransferase 11-2 homolog (S. cerevisiae)
Gene Name: TRMT112
Alternative Gene Name: HSPC152, HSPC170, TRM112, TRMT11-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038812: 86%, ENSRNOG00000021132: 86%
Entrez Gene ID: 51504
Uniprot ID: Q9UI30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRL
• Gene Sequence: MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRL
• Gene ID - Mouse: ENSMUSG00000038812
• Gene ID - Rat: ENSRNOG00000021132
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRMT112 pAb (ATL-HPA039901 w/enhanced validation) – 1 Found

Brūmele, Baiba; Mutso, Margit; Telanne, Lilian; Õunap, Kadri; Spunde, Karīna; Abroi, Aare; Kurg, Reet. Human TRMT112-Methyltransferase Network Consists of Seven Partners Interacting with a Common Co-Factor. International Journal Of Molecular Sciences. 2021;22(24)