Anti TRMT1 pAb (ATL-HPA041130)

Atlas Antibodies

Catalog No.: ATL-HPA041130-25

Protein Description: tRNA methyltransferase 1 homolog (S. cerevisiae)
Gene Name: TRMT1
Alternative Gene Name: FLJ20244, TRM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001909: 92%, ENSRNOG00000002914: 91%
Entrez Gene ID: 55621
Uniprot ID: Q9NXH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EHCGQRHQLGGPMWAEPIHDLDFVGRVLEAVSANPGRFHTSERIRGVLSVITEELPDVPLYYTLDQLSSTIHCNTP
• Gene Sequence: EHCGQRHQLGGPMWAEPIHDLDFVGRVLEAVSANPGRFHTSERIRGVLSVITEELPDVPLYYTLDQLSSTIHCNTP
• Gene ID - Mouse: ENSMUSG00000001909
• Gene ID - Rat: ENSRNOG00000002914
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.