Anti TRIP10 pAb (ATL-HPA073886)

Atlas Antibodies

Catalog No.: ATL-HPA073886-25

Protein Description: thyroid hormone receptor interactor 10
Gene Name: TRIP10
Alternative Gene Name: CIP4, HSTP, STOT, STP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019487: 96%, ENSRNOG00000055524: 89%
Entrez Gene ID: 9322
Uniprot ID: Q15642
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYGLLSEAELEVVPIIA
• Gene Sequence: LQRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYGLLSEAELEVVPIIA
• Gene ID - Mouse: ENSMUSG00000019487
• Gene ID - Rat: ENSRNOG00000055524
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.