Anti TRIM45 pAb (ATL-HPA054308)

Atlas Antibodies

Catalog No.: ATL-HPA054308-25

Protein Description: tripartite motif containing 45
Gene Name: TRIM45
Alternative Gene Name: FLJ13181, RNF99
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033233: 85%, ENSRNOG00000015347: 87%
Entrez Gene ID: 80263
Uniprot ID: Q9H8W5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLPCLHTVCTTCLEQLEPFSVVDIRGGDSDTSSEGSIFQELKPRSLQSQIGILCPVCDAQVDLPMGGVKALTIDHLAVNDVMLE
• Gene Sequence: LLPCLHTVCTTCLEQLEPFSVVDIRGGDSDTSSEGSIFQELKPRSLQSQIGILCPVCDAQVDLPMGGVKALTIDHLAVNDVMLE
• Gene ID - Mouse: ENSMUSG00000033233
• Gene ID - Rat: ENSRNOG00000015347
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.