Anti TRIM39 pAb (ATL-HPA051120)

Atlas Antibodies

Catalog No.: ATL-HPA051120-25

Protein Description: tripartite motif containing 39
Gene Name: TRIM39
Alternative Gene Name: RNF23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045409: 93%, ENSRNOG00000000785: 94%
Entrez Gene ID: 56658
Uniprot ID: Q9HCM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSMVEIAKQLQAVKRKIRDESLCPQHHEALSLFCYEDQEAVCLICAISHTHRAHTVVPLDDATQEYKE
• Gene Sequence: GSMVEIAKQLQAVKRKIRDESLCPQHHEALSLFCYEDQEAVCLICAISHTHRAHTVVPLDDATQEYKE
• Gene ID - Mouse: ENSMUSG00000045409
• Gene ID - Rat: ENSRNOG00000000785
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.