Anti TRIM2 pAb (ATL-HPA035853)

Atlas Antibodies

Catalog No.: ATL-HPA035853-25

Protein Description: tripartite motif containing 2
Gene Name: TRIM2
Alternative Gene Name: KIAA0517, RNF86
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027993: 100%, ENSRNOG00000010124: 100%
Entrez Gene ID: 23321
Uniprot ID: Q9C040
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PMSVTITTKDKDGELCKTGNAYLTAELSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPT
• Gene Sequence: PMSVTITTKDKDGELCKTGNAYLTAELSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPT
• Gene ID - Mouse: ENSMUSG00000027993
• Gene ID - Rat: ENSRNOG00000010124
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.