Anti TRIB1 pAb (ATL-HPA063982)

Atlas Antibodies

Catalog No.: ATL-HPA063982-25

Protein Description: tribbles pseudokinase 1
Gene Name: TRIB1
Alternative Gene Name: C8FW, GIG2, TRB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032501: 88%, ENSRNOG00000004100: 90%
Entrez Gene ID: 10221
Uniprot ID: Q96RU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYLSPP
• Gene Sequence: VRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYLSPP
• Gene ID - Mouse: ENSMUSG00000032501
• Gene ID - Rat: ENSRNOG00000004100
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.