Anti TRDMT1 pAb (ATL-HPA036945)

Atlas Antibodies

Catalog No.: ATL-HPA036945-25

Protein Description: tRNA aspartic acid methyltransferase 1
Gene Name: TRDMT1
Alternative Gene Name: DNMT2, RNMT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026723: 87%, ENSRNOG00000026132: 86%
Entrez Gene ID: 1787
Uniprot ID: O14717
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVLELYSGVGGMHHALRESCIPAQVVAAIDVNTVANEVYKYNFPHTQLLAKTIEGITLEEFDRLSFDMILMSPPCQPFTRIGRQGDMTDSRT
• Gene Sequence: RVLELYSGVGGMHHALRESCIPAQVVAAIDVNTVANEVYKYNFPHTQLLAKTIEGITLEEFDRLSFDMILMSPPCQPFTRIGRQGDMTDSRT
• Gene ID - Mouse: ENSMUSG00000026723
• Gene ID - Rat: ENSRNOG00000026132
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.