Anti TRAPPC13 pAb (ATL-HPA037777)

Atlas Antibodies

Catalog No.: ATL-HPA037777-25

Protein Description: trafficking protein particle complex 13
Gene Name: TRAPPC13
Alternative Gene Name: C5orf44, FLJ13611, FLJ26957, MGC48585
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021711: 100%, ENSRNOG00000012124: 100%
Entrez Gene ID: 80006
Uniprot ID: A5PLN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGETFSSYISVHNDSNQVVKDILVKADLQTSSQRLNLSASNAAVAELKPDCCIDDVIHHEVKEIGTHILVCAVSY
• Gene Sequence: LGETFSSYISVHNDSNQVVKDILVKADLQTSSQRLNLSASNAAVAELKPDCCIDDVIHHEVKEIGTHILVCAVSY
• Gene ID - Mouse: ENSMUSG00000021711
• Gene ID - Rat: ENSRNOG00000012124
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.