Anti TRANK1 pAb (ATL-HPA035508)

Atlas Antibodies

Catalog No.: ATL-HPA035508-25

Protein Description: tetratricopeptide repeat and ankyrin repeat containing 1
Gene Name: TRANK1
Alternative Gene Name: KIAA0342, LBA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062296: 90%, ENSRNOG00000021091: 90%
Entrez Gene ID: 9881
Uniprot ID: O15050
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CKLADSIKAICNAYNRGLSCVLRKKLKGINKGQVSANMKIQKRIPRCYVEDTEAEKGREHVNPEYFPPASAVETEYNIMKFHSFST
• Gene Sequence: CKLADSIKAICNAYNRGLSCVLRKKLKGINKGQVSANMKIQKRIPRCYVEDTEAEKGREHVNPEYFPPASAVETEYNIMKFHSFST
• Gene ID - Mouse: ENSMUSG00000062296
• Gene ID - Rat: ENSRNOG00000021091
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.