Anti TRAF3IP2 pAb (ATL-HPA036352)

Atlas Antibodies

Catalog No.: ATL-HPA036352-25

Protein Description: TRAF3 interacting protein 2
Gene Name: TRAF3IP2
Alternative Gene Name: ACT1, C6orf2, C6orf4, C6orf5, C6orf6, CIKS, DKFZP586G0522
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019842: 99%, ENSRNOG00000000595: 96%
Entrez Gene ID: 10758
Uniprot ID: O43734
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KQDVEGAESQLDEDEHGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLR
• Gene Sequence: KQDVEGAESQLDEDEHGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLR
• Gene ID - Mouse: ENSMUSG00000019842
• Gene ID - Rat: ENSRNOG00000000595
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.