Anti TNPO2 pAb (ATL-HPA071498)

Atlas Antibodies

Catalog No.: ATL-HPA071498-25

Protein Description: transportin 2
Gene Name: TNPO2
Alternative Gene Name: FLJ12155, IPO3, KPNB2B, TRN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031691: 94%, ENSRNOG00000003970: 97%
Entrez Gene ID: 30000
Uniprot ID: O14787
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QDIKPRFHKSRTVTLPHEAERPDGSEDAEDDDD
• Gene Sequence: QDIKPRFHKSRTVTLPHEAERPDGSEDAEDDDD
• Gene ID - Mouse: ENSMUSG00000031691
• Gene ID - Rat: ENSRNOG00000003970
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.