Anti TNIP1 pAb (ATL-HPA037893 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA037893-25

Protein Description: TNFAIP3 interacting protein 1
Gene Name: TNIP1
Alternative Gene Name: ABIN-1, KIAA0113, NAF1, VAN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020400: 87%, ENSRNOG00000010370: 82%
Entrez Gene ID: 10318
Uniprot ID: Q15025
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEGRGPYRIYDPGGSVPSGEASAAFERLVKENSRLKEKMQGIKMLGELLEESQMEATRLRQKAEELVKDNELLPP
• Gene Sequence: MEGRGPYRIYDPGGSVPSGEASAAFERLVKENSRLKEKMQGIKMLGELLEESQMEATRLRQKAEELVKDNELLPP
• Gene ID - Mouse: ENSMUSG00000020400
• Gene ID - Rat: ENSRNOG00000010370
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TNIP1 pAb (ATL-HPA037893 w/enhanced validation) – 2 Found

Kattah, Michael G; Shao, Ling; Rosli, Yenny Y; Shimizu, Hiromichi; Whang, Michael I; Advincula, Rommel; Achacoso, Philip; Shah, Sanjana; Duong, Bao H; Onizawa, Michio; Tanbun, Priscilia; Malynn, Barbara A; Ma, Averil. A20 and ABIN-1 synergistically preserve intestinal epithelial cell survival. The Journal Of Experimental Medicine. 2018;215(7):1839-1852. 

Kuriakose, Jeeba; Redecke, Vanessa; Guy, Cliff; Zhou, Jingran; Wu, Ruiqiong; Ippagunta, Sirish K; Tillman, Heather; Walker, Patrick D; Vogel, Peter; Häcker, Hans. Patrolling monocytes promote the pathogenesis of early lupus-like glomerulonephritis. The Journal Of Clinical Investigation. 2019;129(6):2251-2265.