Anti TMEM52B pAb (ATL-HPA058096 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA058096-25

Protein Description: transmembrane protein 52B
Gene Name: TMEM52B
Alternative Gene Name: C12orf59, FLJ31166
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030160: 75%, ENSRNOG00000058653: 77%
Entrez Gene ID: 120939
Uniprot ID: Q4KMG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLPSSLDTLPGYEEALHMSRFTVAMCGQKAPDLPPVPEEKQLPPTEKESTRIVDSWN
• Gene Sequence: QLPSSLDTLPGYEEALHMSRFTVAMCGQKAPDLPPVPEEKQLPPTEKESTRIVDSWN
• Gene ID - Mouse: ENSMUSG00000030160
• Gene ID - Rat: ENSRNOG00000058653
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.