Anti TMEM263 pAb (ATL-HPA042339)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042339-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TMEM263
Alternative Gene Name: C12orf23, MGC17943
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060935: 93%, ENSRNOG00000006987: 93%
Entrez Gene ID: 90488
Uniprot ID: Q8WUH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QQEIPSYLNDEPPEGSMKDHPQQQPGMLSR |
| Gene Sequence | QQEIPSYLNDEPPEGSMKDHPQQQPGMLSR |
| Gene ID - Mouse | ENSMUSG00000060935 |
| Gene ID - Rat | ENSRNOG00000006987 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMEM263 pAb (ATL-HPA042339) | |
| Datasheet | Anti TMEM263 pAb (ATL-HPA042339) Datasheet (External Link) |
| Vendor Page | Anti TMEM263 pAb (ATL-HPA042339) at Atlas Antibodies |
| Documents & Links for Anti TMEM263 pAb (ATL-HPA042339) | |
| Datasheet | Anti TMEM263 pAb (ATL-HPA042339) Datasheet (External Link) |
| Vendor Page | Anti TMEM263 pAb (ATL-HPA042339) |