Anti TMEM263 pAb (ATL-HPA042339)

Atlas Antibodies

Catalog No.:
ATL-HPA042339-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 263
Gene Name: TMEM263
Alternative Gene Name: C12orf23, MGC17943
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060935: 93%, ENSRNOG00000006987: 93%
Entrez Gene ID: 90488
Uniprot ID: Q8WUH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QQEIPSYLNDEPPEGSMKDHPQQQPGMLSR
Gene Sequence QQEIPSYLNDEPPEGSMKDHPQQQPGMLSR
Gene ID - Mouse ENSMUSG00000060935
Gene ID - Rat ENSRNOG00000006987
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM263 pAb (ATL-HPA042339)
Datasheet Anti TMEM263 pAb (ATL-HPA042339) Datasheet (External Link)
Vendor Page Anti TMEM263 pAb (ATL-HPA042339) at Atlas Antibodies

Documents & Links for Anti TMEM263 pAb (ATL-HPA042339)
Datasheet Anti TMEM263 pAb (ATL-HPA042339) Datasheet (External Link)
Vendor Page Anti TMEM263 pAb (ATL-HPA042339)