Anti TMEM252 pAb (ATL-HPA079457 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA079457-25

Protein Description: transmembrane protein 252
Gene Name: TMEM252
Alternative Gene Name: C9orf71, MGC34760
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048572: 69%, ENSRNOG00000025476: 65%
Entrez Gene ID: 169693
Uniprot ID: Q8N6L7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SNYRQVTESKGVLRHMLRQHLAHGALPVATVDRPDFYPPAYEESLEVEKQSCPAE
• Gene Sequence: SNYRQVTESKGVLRHMLRQHLAHGALPVATVDRPDFYPPAYEESLEVEKQSCPAE
• Gene ID - Mouse: ENSMUSG00000048572
• Gene ID - Rat: ENSRNOG00000025476
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.