Anti TMEM208 pAb (ATL-HPA041949 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041949-100

Protein Description: transmembrane protein 208
Gene Name: TMEM208
Alternative Gene Name: HSPC171
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014856: 93%, ENSRNOG00000015974: 90%
Entrez Gene ID: 29100
Uniprot ID: Q9BTX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PWFTADSGTPAPEHNEKRQRRQERRQMKRL
• Gene Sequence: PWFTADSGTPAPEHNEKRQRRQERRQMKRL
• Gene ID - Mouse: ENSMUSG00000014856
• Gene ID - Rat: ENSRNOG00000015974
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.