Anti TMEM165 pAb (ATL-HPA038299 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038299-25

Protein Description: transmembrane protein 165
Gene Name: TMEM165
Alternative Gene Name: GDT1, TMPT27, TPARL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029234: 92%, ENSRNOG00000002199: 92%
Entrez Gene ID: 55858
Uniprot ID: Q9HC07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: REGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQ
• Gene Sequence: REGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQ
• Gene ID - Mouse: ENSMUSG00000029234
• Gene ID - Rat: ENSRNOG00000002199
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TMEM165 pAb (ATL-HPA038299 w/enhanced validation) – 2 Found

Foulquier, François; Amyere, Mustapha; Jaeken, Jaak; Zeevaert, Renate; Schollen, Els; Race, Valérie; Bammens, Riet; Morelle, Willy; Rosnoblet, Claire; Legrand, Dominique; Demaegd, Didier; Buist, Neil; Cheillan, David; Guffon, Nathalie; Morsomme, Pierre; Annaert, Willem; Freeze, Hudson H; Van Schaftingen, Emile; Vikkula, Miikka; Matthijs, Gert. TMEM165 deficiency causes a congenital disorder of glycosylation. American Journal Of Human Genetics. 2012;91(1):15-26. 

Snyder, Nathan A; Palmer, Mitchell V; Reinhardt, Timothy A; Cunningham, Kyle W. Milk biosynthesis requires the Golgi cation exchanger TMEM165. The Journal Of Biological Chemistry. 2019;294(9):3181-3191.